PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn204961
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family MYB_related
Protein Properties Length: 316aa    MW: 35530 Da    PI: 6.8811
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn204961genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.76.4e-19118162147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T+eEdel+++++ +lG++ W++Ia +++ gRt++++k++w+++
       Achn204961 118 RGNFTEEEDELIIKLHSLLGNK-WSLIAGRLP-GRTDNEIKNYWNTH 162
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.1E-134756IPR009057Homeodomain-like
PROSITE profilePS500904.05499112IPR017877Myb-like domain
SuperFamilySSF466891.03E-2299169IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.1E-1399125IPR009057Homeodomain-like
PROSITE profilePS5129429.427113167IPR017930Myb domain
SMARTSM007174.6E-18117165IPR001005SANT/Myb domain
PfamPF002494.3E-17118162IPR001005SANT/Myb domain
CDDcd001675.21E-13120163No hitNo description
Gene3DG3DSA:1.10.10.609.3E-25126164IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MQEENTIWER DTPHLMELGT RSSALTILDW DRWIQIAVRH PIGDLWWENI KHQLQDMLRH  60
SDIKGNELRK PSGSLYTYPM PDCMCKQHSD VGNEDGLLRC GKSCRLRWIN YLRPDLKRGN  120
FTEEEDELII KLHSLLGNKW SLIAGRLPGR TDNEIKNYWN THIKRKLISR GVDPQTHRPL  180
TATTAAANSQ FDFRNASQVP SLSLTEFALM SQSTLITSGE SLDDGKCSSG TTEEADPQPP  240
PPHKNCQSVD LDLSIGLGPY HSRTRASSSS NSAESKLHKM EVPFAAEAVC LCWQLGFQSG  300
GQLCNNCQSN QGLCR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-229916740108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF5951240.0KF595124.1 Actinidia chinensis MYB1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010104477.13e-78Transcription factor
SwissprotP813953e-67MYB30_ANTMA; Myb-related protein 330
TrEMBLV5QMU91e-144V5QMU9_ACTCH; MYB1
STRINGSolyc06g065100.2.18e-71(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09460.18e-56myb domain protein 6